• Gene id: 8509

Gene Summary

• Gene Symbol: NDST2   Gene   UCSC   Ensembl
• Aliases: HSST2, N-HSST 2, NST2
• Gene name: N-deacetylase and N-sulfotransferase 2
• Alternate names: bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2, N-heparan sulfate sulfotransferase 2, glucosaminyl N-deacetylase/N-sulfotransferase 2,
• Gene location: 10q22.2 (73811819: 73801915)     Exons: 16     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the N-deacetylase/N-sulfotransferase subfamily of the sulfotransferase 1 proteins. The encoded enzyme has dual functions in processing glucosamine and heparin polymers, including N-deacetylation and N-sulfation. The encoded p
• OMIM: 138945

Protein Summary

• Protein general information: P52849  
  • Name: Bifunctional heparan sulfate N deacetylase/N sulfotransferase 2 (EC 2.8.2.8) (Glucosaminyl N deacetylase/N sulfotransferase 2) (NDST 2) (N heparan sulfate sulfotransferase 2) (N HSST 2) [Includes: Heparan sulfate N deacetylase 2 (EC 3. . . ); Heparan sulf
  • Length: 883  
  • Mass: 100875
• Sequence:

  MLQLWKVVRPARQLELHRLILLLIAFSLGSMGFLAYYVSTSPKAKEPLPLPLGDCSSGGAAGPGPARPPVPPRPP
  RPPETARTEPVVLVFVESAYSQLGQEIVAILESSRFRYSTELAPGRGDMPTLTDNTHGRYVLVIYENLLKYVNLD
  AWSRELLDRYCVEYGVGIIGFFRAHEHSLLSAQLKGFPLFLHSNLGLRDYQVNPSAPLLHLTRPSRLEPGPLPGD
  DWTIFQSNHSTYEPVLLASLRPAEPAVPGPVLRRARLPTVVQDLGLHDGIQRVLFGHGLSFWLHKLIFVDAVAYL
  TGKRLCLDLDRYILVDIDDIFVGKEGTRMKVADVEALLTTQNKLRTLVPNFTFNLGFSGKFYHTGTEEEDAGDDM
  LLKHRKEFWWFPHMWSHMQPHLFHNRSVLADQMRLNKQFALEHGIPTDLGYAVAPHHSGVYPIHTQLYEAWKSVW
  GIQVTSTEEYPHLRPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSRELDRSIRGGELFLTVLLNPISIF
  MTHLSNYGNDRLGLYTFESLVRFLQCWTRLRLQTLPPVPLAQKYFELFPQERSPLWQNPCDDKRHKDIWSKEKTC
  DRLPKFLIVGPQKTGTTAIHFFLSLHPAVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDFFPVPSNASTDFLFEK
  SATYFDSEVVPRRGAALLPRAKIITVLTNPADRAYSWYQHQRAHGDPVALNYTFYQVISASSQTPLALRSLQNRC
  LVPGYYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGFWCQGLEGGKT
  RCLGRSKGRRYPDMDTESRLFLTDFFRNHNLELSKLLSRLGQPVPSWLREELQHSSLG

• Structural information:
  • Interpro: IPR021930  IPR037359  IPR027417  IPR000863  
  • STRING: ENSP00000310657
• Other Databases: GeneCards:  NDST2  Malacards:  NDST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IBA	biological process
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IBA	molecular function
GO:0019213	deacetylase activity	IBA	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IEA	biological process
GO:0030210	heparin biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881