• Gene id: 8508

Gene Summary

• Gene Symbol: NIPSNAP1   Gene   UCSC   Ensembl
• Gene name: nipsnap homolog 1
• Alternate names: protein NipSnap homolog 1, 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1,
• Gene location: 22q12.2 (29581112: 29554807)     Exons: 10     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. A similar protein in mice inhibits the calcium channel TRPV6, and is also localized to the inner mitochondrial membrane where it may play a role in m
• OMIM: 616019

Protein Summary

• Protein general information: Q9BPW8  
  • Name: Protein NipSnap homolog 1 (NipSnap1)
  • Length: 284  
  • Mass: 33310
  • Tissue specificity: Ubiquitous. Highest expression in liver.
• Sequence:

  MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQ
  FHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLE
  FRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQI
  GELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ

• Structural information:
  • Interpro: IPR011008  IPR012577  
  • STRING: ENSP00000216121
• Other Databases: GeneCards:  NIPSNAP1  Malacards:  NIPSNAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0019233	sensory perception of pain	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0097060	synaptic membrane	IEA	cellular component
GO:0019233	sensory perception of pain	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0042165	neurotransmitter binding	IEA	molecular function
GO:0005739	mitochondrion	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0019233	sensory perception of pain	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0097060	synaptic membrane	IEA	cellular component
GO:0019233	sensory perception of pain	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0042165	neurotransmitter binding	IEA	molecular function
GO:0005739	mitochondrion	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881