• Gene id: 84987

Gene Summary

• Gene Symbol: COX14   Gene   UCSC   Ensembl
• Aliases: C12orf62, PCAG1
• Gene name: cytochrome c oxidase assembly factor COX14
• Alternate names: cytochrome c oxidase assembly protein COX14, COX14 cytochrome c oxidase assembly homolog, COX14, cytochrome c oxidase assembly factor, cytochrome c oxidase assembly homolog 14,
• Gene location: 12q13.12 (50112235: 50120452)     Exons: 3     NC_000012.12
• Gene summary(Entrez): This gene encodes a small single-pass transmembrane protein that localizes to mitochondria. This protein may play a role in coordinating the early steps of cytochrome c oxidase (COX; also known as complex IV) subunit assembly and, in particular, the synth
• OMIM: 618818

Protein Summary

• Protein general information: Q96I36  
  • Name: Cytochrome c oxidase assembly protein COX14
  • Length: 57  
  • Mass: 6600
• Sequence:

  MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM

• Structural information:
  • Interpro: IPR029208  
  • STRING: ENSP00000446524
• Other Databases: GeneCards:  COX14  Malacards:  COX14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033617	mitochondrial cytochrome c oxidase assembly	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0033617	mitochondrial cytochrome c oxidase assembly	IMP	biological process
GO:0033617	mitochondrial cytochrome c oxidase assembly	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0033617	mitochondrial cytochrome c oxidase assembly	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0033617	mitochondrial cytochrome c oxidase assembly	IMP	biological process
GO:0033617	mitochondrial cytochrome c oxidase assembly	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis

Diseases

Associated diseases	References
Cytochrome c oxidase	KEGG:H01368
Cytochrome c oxidase	KEGG:H01368
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881