• Gene id: 84966

Gene Summary

• Gene Symbol: IGSF21   Gene   UCSC   Ensembl
• Gene name: immunoglobin superfamily member 21
• Alternate names: immunoglobulin superfamily member 21,
• Gene location: 1p36.13 (18107745: 18378482)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein which has two immunoglobulin (Ig) domains and is a member of the immunoglobulin superfamily. Proteins in this superfamily are usually found on or in cell membranes and act as receptors in immune response pathways. [provided by
• OMIM: 611163

Protein Summary

• Protein general information: Q96ID5  
  • Name: Immunoglobulin superfamily member 21 (IgSF21)
  • Length: 467  
  • Mass: 51835
• Sequence:

  MRTAPSLRRCVCLLLAAILDLARGYLTVNIEPLPPVVAGDAVTLKCNFKTDGRMREIVWYRVTDGGTIKQKIFTF
  DAMFSTNYSHMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGIYDRATREKVVLASGNIFLNVMAPPTSIEVV
  AADTPAPFSRYQAQNFTLVCIVSGGKPAPMVYFKRDGEPIDAVPLSEPPAASSGPLQDSRPFRSLLHRDLDDTKM
  QKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHSAEPTYFLRHSRTPSSDGTVE
  VRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVAPKGPKIVMTPSRARVGDTVRILVHGFQNEVFPEPM
  FTWTRVGSRLLDGSAEFDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTEDSNGSIGPT
  GARLTLVLALTVILELT

• Structural information:
  • Protein Domains: (25..13-)
    (/note="Ig-like-1)
    (344..42-)
    (/note="Ig-like-2")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000251296
• Other Databases: GeneCards:  IGSF21  Malacards:  IGSF21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0005912	adherens junction	IBA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0060077	inhibitory synapse	ISS	cellular component
GO:0042734	presynaptic membrane	ISS	cellular component
GO:0031362	anchored component of external side of plasma membrane	ISS	cellular component
GO:0060074	synapse maturation	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0060074	synapse maturation	IEA	biological process
GO:0031362	anchored component of external side of plasma membrane	IEA	cellular component
GO:0060077	inhibitory synapse	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq