• Gene id: 84964

Gene Summary

• Gene Symbol: ALKBH6   Gene   UCSC   Ensembl
• Aliases: ABH6
• Gene name: alkB homolog 6
• Alternate names: alpha-ketoglutarate-dependent dioxygenase alkB homolog 6, alkB, alkylation repair homolog 6, alkylated DNA repair protein alkB homolog 6, alkylation repair homolog 6, probable alpha-ketoglutarate-dependent dioxygenase ABH6,
• Gene location: 19q13.12 (36014238: 36009119)     Exons: 8     NC_000019.10
• OMIM: 602381

Protein Summary

• Protein general information: Q3KRA9  
  • Name: Alpha ketoglutarate dependent dioxygenase alkB homolog 6 (EC 1.14.11. ) (Alkylated DNA repair protein alkB homolog 6)
  • Length: 238  
  • Mass: 26483
  • Tissue specificity: Widely expressed, with highest expression in testis and pancreas. {ECO
• Sequence:

  MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERL
  PPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTE
  QPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLHGIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRR
  VPRVLRAGLLLGK

• Structural information:
  • Protein Domains: (96..22-)
    (/note="Fe2OG-dioxygenase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00805"-)
  • Interpro: IPR027450  IPR037151  IPR032862  IPR005123  
  • Prosite: PS51471
  • STRING: ENSP00000368152
• Other Databases: GeneCards:  ALKBH6  Malacards:  ALKBH6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881