• Gene id: 84958

Gene Summary

• Gene Symbol: SYTL1   Gene   UCSC   Ensembl
• Aliases: JFC1, SLP1
• Gene name: synaptotagmin like 1
• Alternate names: synaptotagmin-like protein 1, NADPH oxidase-related, C2 domain-containing protein, exophilin-7,
• Gene location: 1p36.11 (27342021: 27353931)     Exons: 14     NC_000001.11
• OMIM: 604418

Protein Summary

• Protein general information: Q8IYJ3  
  • Name: Synaptotagmin like protein 1 (Exophilin 7) (Protein JFC1)
  • Length: 562  
  • Mass: 61857
  • Tissue specificity: Highly expressed in bone marrow and lymphoid tissues. Detected at lower levels in cerebellum, occipital lobe, prostate, stomach, kidney, appendix, lung and trachea. Expressed in cytotoxic T-lymphocytes (CTL). {ECO
• Sequence:

  MPQRGHPSQEGLWALPSLPMAHGPKPETEGLLDLSFLTEEEQEAIAGVLQRDARLRQLEEGRVSKLRASVADPGQ
  LKILTGDWFQEARSQRHHNAHFGSDLVRASMRRKKSTRGDQAPGHDREAEAAVKEKEEGPEPRLTIDEAPQERLR
  ETEGPDFPSPSVPLKASDPEEASQAQEDPGQGDQQVCAEEADPELEPASGGEQEPRPQQAQTKAASQILENGEEA
  PGPDPSLDRMLSSSSSVSSLNSSTLSGSQMSLSGDAEAVQVRGSVHFALHYEPGAAELRVHVIQCQGLAAARRRR
  SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQAELQGRVLSLSVWHRESLGRNIFLGEVEVPLDTWD
  WGSEPTWLPLQPRVPPSPDDLPSRGLLALSLKYVPAGSEGAGLPPSGELHFWVKEARDLLPLRAGSLDTYVQCFV
  LPDDSQASRQRTRVVRRSLSPVFNHTMVYDGFGPADLRQACAELSLWDHGALANRQLGGTRLSLGTGSSYGLQVP
  WMDSTPEEKQLWQALLEQPCEWVDGLLPLRTNLAPRT

• Structural information:
  • Protein Domains: (31..8-)
    (/note="RabBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00234-)
    (266..38-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (398..52-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR010911  IPR028378  IPR013083  
  • Prosite: PS50004 PS50916
  • STRING: ENSP00000440704
• Other Databases: GeneCards:  SYTL1  Malacards:  SYTL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0042043	neurexin family protein binding	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006887	exocytosis	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031528	microvillus membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042470	melanosome	ISS	cellular component
GO:0042043	neurexin family protein binding	ISS	molecular function
GO:0019897	extrinsic component of plasma membrane	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R