• Gene id: 84935

Gene Summary

• Gene Symbol: MEDAG   Gene   UCSC   Ensembl
• Aliases: AWMS3, C13orf33, MEDA-4, MEDA4, hAWMS3
• Gene name: mesenteric estrogen dependent adipogenesis
• Alternate names: mesenteric estrogen-dependent adipogenesis protein, activated in W/Wv mouse stomach 3 homolog, mesenteric estrogen-dependent adipose 4,
• Gene location: 13q12.3 (30906270: 30925576)     Exons: 6     NC_000013.11
• OMIM: 0

Protein Summary

• Protein general information: Q5VYS4  
  • Name: Mesenteric estrogen dependent adipogenesis protein (Activated in W/Wv mouse stomach 3 homolog) (hAWMS3) (Mesenteric estrogen dependent adipose 4) (MEDA 4)
  • Length: 303  
  • Mass: 34190
  • Tissue specificity: Highly expressed in the visceral fat depot. {ECO
• Sequence:

  MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVARPGEPAAARGGFNVFGD
  GLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQ
  GMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLS
  STSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPN
  QFI

• Structural information:
  • Interpro: IPR039230  
  • STRING: ENSP00000369849
• Other Databases: GeneCards:  MEDAG  Malacards:  MEDAG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)