• Gene id: 84929

Gene Summary

• Gene Symbol: FIBCD1   Gene   UCSC   Ensembl
• Gene name: fibrinogen C domain containing 1
• Alternate names: fibrinogen C domain-containing protein 1,
• Gene location: 9q34.12 (100186028: 100150093)     Exons: 13     NC_000010.11
• Gene summary(Entrez): FIBCD1 is a conserved type II transmembrane endocytic receptor that binds chitin and is located primarily in the intestinal brush border (Schlosser et al., 2009 [PubMed 19710473]).[supplied by OMIM, Apr 2010]
• OMIM: 613357

Protein Summary

• Protein general information: Q8N539  
  • Name: Fibrinogen C domain containing protein 1
  • Length: 461  
  • Mass: 50744
  • Tissue specificity: Expressed in the small and large intestinal epithelial cells with a highly polarized localization to the apical surface corresponding to the brush border and in the ducts of the salivary gland. {ECO
• Sequence:

  MVNDRWKTMGGAAQLEDRPRDKPQRPSCGYVLCTVLLALAVLLAVAVTGAVLFLNHAHAPGTAPPPVVSTGAASA
  NSALVTVERADSSHLSILIDPRCPDLTDSFARLESAQASVLQALTEHQAQPRLVGDQEQELLDTLADQLPRLLAR
  ASELQTECMGLRKGHGTLGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQRA
  PARGTRPRGCATGSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWD
  AYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFSVDPEEDGYPLTVADYSGTA
  GDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTGWQYSLKFS
  EMKIRPVREDR

• Structural information:
  • Protein Domains: (235..45-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR014716  IPR014715  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • PDB: 4M7F 4M7H
  • PDBsum: 4M7F 4M7H
  • STRING: ENSP00000361413
• Other Databases: GeneCards:  FIBCD1  Malacards:  FIBCD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0008061	chitin binding	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0008061	chitin binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq