• Gene id: 84918

Gene Summary

• Gene Symbol: LRP11   Gene   UCSC   Ensembl
• Aliases: MANSC3, bA350J20.3
• Gene name: LDL receptor related protein 11
• Alternate names: low-density lipoprotein receptor-related protein 11, LRP-11,
• Gene location: 6q25.1 (149864358: 149818756)     Exons: 9     NC_000006.12

Protein Summary

• Protein general information: Q86VZ4  
  • Name: Low density lipoprotein receptor related protein 11 (LRP 11)
  • Length: 500  
  • Mass: 53311
• Sequence:

  MASVAQESAGSQRRLPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLEEFRRQLQQERPQEEL
  ELELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRCSVAVVELPRR
  PAPPAAVLGCYLFNCTARGRNVCKFALHSGYSSYSLSRAPDGAALATARASPRQEKDAPPLSKAGQDVVLHLPTD
  GVVLDGRESTDDHAIVQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSVTVLRAA
  YSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLDRKMVTHTAASPALPRTTGPSEDAGG
  DSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSSSSGKNRKEESYIFESKGDGGGGEHPAPETG
  AVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEESDYLINGMYL

• Structural information:
  • Protein Domains: (99..18-)
    (/note="MANSC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00341-)
    (210..30-)
    (/note="PKD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00151-)
    (309..34-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR013783  IPR036055  IPR023415  IPR002172  IPR042484   IPR013980  IPR011106  IPR022409  IPR000601  IPR035986  
  • Prosite: PS01209 PS50068 PS50986 PS50093
  • CDD: cd00112
  • STRING: ENSP00000239367
• Other Databases: GeneCards:  LRP11  Malacards:  LRP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051219	phosphoprotein binding	IMP	molecular function
GO:0005886	plasma membrane	IC	cellular component
GO:0042594	response to starvation	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009414	response to water deprivation	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0033555	multicellular organismal response to stress	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)