• Gene id: 84904

Gene Summary

• Gene Symbol: ARHGEF39   Gene   UCSC   Ensembl
• Aliases: C9orf100
• Gene name: Rho guanine nucleotide exchange factor 39
• Alternate names: rho guanine nucleotide exchange factor 39, Rho guanine nucleotide exchange factor (GEF) 39, vav-like protein C9orf100,
• Gene location: 9p13.3 (35665204: 35658874)     Exons: 4     NC_000009.12

Protein Summary

• Protein general information: Q8N4T4  
  • Name: Rho guanine nucleotide exchange factor 39
  • Length: 335  
  • Mass: 38295
  • Tissue specificity: Strongly expressed in hepatocellular carcinoma (HCC) compared with their non-cancerous counterparts. {ECO
• Sequence:

  MELSCPGSRCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILKAKGTLRPPERQALFGSWELIYG
  ASQELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEFGGLQLQDLLP
  LPLQRLQQYENLVVALAENTGPNSPDHQQLTRAARLISETAQRVHTIGQKQKNDQHLRRVQALLSGRQAKGLTSG
  RWFLRQGWLLVVPPHGEPRPRMFFLFTDVLLMAKPRPPLHLLRSGTFACKALYPMAQCHLSRVFGHSGGPCGGLL
  SLSFPHEKLLLMSTDQEELSRWYHSLTWAISSQKN

• Structural information:
  • Protein Domains: (22..19-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (227..33-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR042987  IPR035899  IPR000219  IPR011993  IPR001849  
  • Prosite: PS50010 PS50003
  • STRING: ENSP00000367638
• Other Databases: GeneCards:  ARHGEF39  Malacards:  ARHGEF39

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881