• Gene id: 84898

Gene Summary

• Gene Symbol: PLXDC2   Gene   UCSC   Ensembl
• Aliases: TEM7R
• Gene name: plexin domain containing 2
• Alternate names: plexin domain-containing protein 2, 1200007L24Rik, tumor endothelial marker 7-related protein,
• Gene location: 10p12.31 (19816214: 20289855)     Exons: 15     NC_000010.11
• OMIM: 606827

Protein Summary

• Protein general information: Q6UX71  
  • Name: Plexin domain containing protein 2 (Tumor endothelial marker 7 related protein)
  • Length: 529  
  • Mass: 59583
  • Tissue specificity: Expressed in the endothelial cells of the stroma but not in the endothelial cells of normal colonic tissue. {ECO
• Sequence:

  MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLDFLKAV
  DTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSASRDLWVNIDQMEKDKVKIHGILS
  NTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTAL
  VVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRT
  IYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEES
  KEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKGG
  TLHAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIV
  SEQC

• Structural information:
  • Protein Domains: (327..37-)
    (/note="PSI"-)
  • Interpro: IPR002165  IPR031152  IPR031154  IPR016201  
  • DIP: 46251
  • STRING: ENSP00000366460
• Other Databases: GeneCards:  PLXDC2  Malacards:  PLXDC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq