• Gene id: 84885

Gene Summary

• Gene Symbol: ZDHHC12   Gene   UCSC   Ensembl
• Aliases: DHHC-12, ZNF400
• Gene name: zinc finger DHHC-type palmitoyltransferase 12
• Alternate names: probable palmitoyltransferase ZDHHC12, zinc finger DHHC domain-containing protein 12, zinc finger DHHC-type containing 12, zinc finger protein 400,
• Gene location: 9q34.11 (128724137: 128720868)     Exons: 5     NC_000009.12
• OMIM: 618365

Protein Summary

• Protein general information: Q96GR4  
  • Name: Probable palmitoyltransferase ZDHHC12 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 12) (DHHC 12) (Zinc finger protein 400)
  • Length: 267  
  • Mass: 30813
• Sequence:

  MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQ
  PQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQL
  VVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQ
  RPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV

• Structural information:
  • Protein Domains: (97..14-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000361748
• Other Databases: GeneCards:  ZDHHC12  Malacards:  ZDHHC12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0018345	protein palmitoylation	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq