• Gene id: 84830

Gene Summary

• Gene Symbol: ADTRP   Gene   UCSC   Ensembl
• Aliases: AIG1L, C6orf105, dJ413H6.1
• Gene name: androgen dependent TFPI regulating protein
• Alternate names: androgen-dependent TFPI-regulating protein, FAHFA hydrolase ADTRP, androgen-dependent TPF1-regulating protein, fatty acid esters of hydroxy fatty acids hydrolase ADTRP,
• Gene location: 6p24.1 (11779627: 11713522)     Exons: 1     NC_000006.12
• OMIM: 614348

Protein Summary

• Protein general information: Q96IZ2  
  • Name: Androgen dependent TFPI regulating protein (Fatty acid esters of hydroxy fatty acids hydrolase ADTRP) (FAHFA hydrolase ADTRP) (EC 3.1. . )
  • Length: 230  
  • Mass: 26842
  • Tissue specificity: Expressed in cultured endothelial cells and in placenta. {ECO
• Sequence:

  MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKD
  IKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYP
  SKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQP
  RKKRK

• Structural information:
  • Interpro: IPR006838  
  • STRING: ENSP00000229583
• Other Databases: GeneCards:  ADTRP  Malacards:  ADTRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:1903038	negative regulation of leukocyte cell-cell adhesion	IMP	biological process
GO:0002686	negative regulation of leukocyte migration	IMP	biological process
GO:2000402	negative regulation of lymphocyte migration	IMP	biological process
GO:0140052	cellular response to oxidised low-density lipoprotein particle stimulus	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0003332	negative regulation of extracellular matrix constituent secretion	IMP	biological process
GO:0050709	negative regulation of protein secretion	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0042758	long-chain fatty acid catabolic process	IMP	biological process
GO:0016787	hydrolase activity	IMP	molecular function
GO:0030195	negative regulation of blood coagulation	IMP	biological process
GO:0071383	cellular response to steroid hormone stimulus	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray