• Gene id: 84792

Gene Summary

• Gene Symbol: FAM220A   Gene   UCSC   Ensembl
• Aliases: ACPIN1, C7orf70, SIPAR
• Gene name: family with sequence similarity 220 member A
• Alternate names: protein FAM220A, STAT3-interacting protein as a repressor, acrosomal protein 1,
• Gene location: 7p22.1 (6348966: 6329410)     Exons: 2     NC_000007.14

Protein Summary

• Protein general information: Q7Z4H9  
  • Name: Protein FAM220A (STAT3 interacting protein as a repressor)
  • Length: 259  
  • Mass: 28021
• Sequence:

  MRDRRGPLGTCLAQVQQAGGGDSDKLSCSLKKRMPEGPWPADAPSWMNKPVVDGNSQSEALSLEMRKDPSGAGLW
  LHSGGPVLPYVRESVRRNPASAATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDGHRGQCPKGEP
  RVSRLPRHQKVPEMGSFQDDPPSAFPKGLGSELEPACLHSILSATLHVYPEVLLSEETKRIFLDRLKPMFSKQTI
  EFKKMLKSTSDGLQITLGLLALQPFELANTLCHS

• Structural information:
  • Interpro: IPR040355  IPR029155  
  • STRING: ENSP00000317289
• Other Databases: GeneCards:  FAM220A  Malacards:  FAM220A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097677	STAT family protein binding	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq