• Gene id: 84679

Gene Summary

• Gene Symbol: SLC9A7   Gene   UCSC   Ensembl
• Aliases: MRX108, NHE-7, NHE7, SLC9A6
• Gene name: solute carrier family 9 member A7
• Alternate names: sodium/hydrogen exchanger 7, Na(+)/H(+) exchanger 7, nonselective sodium potassium/proton exchanger, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7,
• Gene location: Xp11.3 (17737448: 17754987)     Exons: 8     NC_000023.11
• Gene summary(Entrez): This gene encodes a sodium and potassium/ proton antiporter that is a member of the solute carrier family 9 protein family. The encoded protein is primarily localized to the trans-Golgi network and is involved in maintaining pH homeostasis in organelles a
• OMIM: 300368

Protein Summary

• Protein general information: Q96T83  
  • Name: Sodium/hydrogen exchanger 7 (Na(+)/H(+) exchanger 7) (NHE 7) (Solute carrier family 9 member 7)
  • Length: 725  
  • Mass: 80131
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MEPGDAARPGSGRATGAPPPRLLLLPLLLGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLL
  TFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGRDKSLSCTQEDRAFSTLLVNVSGKF
  FEYTLKGEISPGKINSVEQNDMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFI
  IGNLMYGVVKLMKIMGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSS
  SIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVNANVTKFTKLHCFPLLETALFFLMSWSTFLLA
  EACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLAENFIFSYMGLALFTFQKHVFSPIFIIGAFV
  AIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIG
  GGTTPMLSWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRL
  WYSFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGS
  SSSHTASTSLEGSRRTKSSSEEVLERDLGMGDQKVSSRGTRLVFPLEDNA

• Structural information:
  • Interpro: IPR006153  IPR018422  IPR002090  IPR004709  
  • STRING: ENSP00000480916
• Other Databases: GeneCards:  SLC9A7  Malacards:  SLC9A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098719	sodium ion import across plasma membrane	IBA	biological process
GO:0055037	recycling endosome	IBA	cellular component
GO:0015385	sodium:proton antiporter activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0051453	regulation of intracellular pH	IBA	biological process
GO:0015386	potassium:proton antiporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1905526	regulation of Golgi lumen acidification	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006812	cation transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015299	solute:proton antiporter activity	IEA	molecular function
GO:0015385	sodium:proton antiporter activity	IEA	molecular function
GO:0006885	regulation of pH	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0015297	antiporter activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0006811	ion transport	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0015386	potassium:proton antiporter activity	IDA	molecular function
GO:0006885	regulation of pH	IDA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0015385	sodium:proton antiporter activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881