Search Result
| Gene id | 84650 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | EBPL Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | EBRP | ||||||||||||||||||||||||||||||||||||||||
| Gene name | EBP like | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | emopamil-binding protein-like, emopamil binding protein like, emopamil binding related protein, delta8-delta7 sterol isomerase related protein, emopamil-binding-related protein, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
13q14.2 (49691486: 49660673) Exons: 6 NC_000013.11 |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 312861 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9BY08 Name: Emopamil binding protein like (Emopamil binding related protein) Length: 206 Mass: 23204 Tissue specificity: Widely expressed with highest levels in liver, lung and kidney. {ECO | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNVANSDG LIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELYGCWMTFLPEW LTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: EBPL  Malacards: EBPL | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||