• Gene id: 84628

Gene Summary

• Gene Symbol: NTNG2   Gene   UCSC   Ensembl
• Aliases: LHLL9381, Lmnt2, NEDBASH, NTNG1, bA479K20.1
• Gene name: netrin G2
• Alternate names: netrin-G2, bA479K20.1 (novel protein), laminet 2, netrin G1,
• Gene location: 9q34.13 (132161233: 132244533)     Exons: 22     NC_000009.12
• OMIM: 614719

Protein Summary

• Protein general information: Q96CW9  
  • Name: Netrin G2 (Laminet 2)
  • Length: 530  
  • Mass: 59799
• Sequence:

  MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPY
  LCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMV
  LEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGP
  DLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
  GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSFGNCECYGHSNRCSYIDFLNVVTCVS
  CKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCECREGAAGPKCDDCLPTHYWRQG
  CYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPRCDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLA
  ARLGR

• Structural information:
  • Protein Domains: (35..28-)
    (/note="Laminin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00466-)
    (287..34-)
    1 (/note="Laminin-EGF-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00460-)
    (353..40-)
    2 (/note="Laminin-EGF-like)
    (/evidence="ECO:-)
  • Interpro: IPR013032  IPR000742  IPR002049  IPR008211  IPR038684  
  • Prosite: PS00022 PS01186 PS50026 PS01248 PS50027 PS51117
  • PDB: 3TBD 3ZYG 3ZYI
  • PDBsum: 3TBD 3ZYG 3ZYI
  • STRING: ENSP00000376921
• Other Databases: GeneCards:  NTNG2  Malacards:  NTNG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009888	tissue development	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0010975	regulation of neuron projection development	ISS	biological process
GO:0150011	regulation of neuron projection arborization	ISS	biological process
GO:2001222	regulation of neuron migration	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0099029	anchored component of presynaptic active zone membrane	IEA	cellular component
GO:0098698	postsynaptic specialization assembly	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007409	axonogenesis	ISS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0046658	anchored component of plasma membrane	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray