|
Gene id |
84569 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
LYZL1 Gene UCSC Ensembl |
|
Aliases |
KAAG648, LYC2, LYZD1, PRO1278, bA534G20.1 |
|
Gene name |
lysozyme like 1 |
|
Alternate names |
lysozyme-like protein 1, lysozyme D1, |
|
Gene location |
10p12.1-p11.23 (29289050: 29318327) Exons: 10 NC_000010.11
|
Protein Summary
|
| Protein general information
| Q6UWQ5
Name: Lysozyme like protein 1 (EC 3.2.1.17)
Length: 148 Mass: 16654
|
| Sequence |
MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIF QINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS
|
| Structural information |
|
| Other Databases |
GeneCards: LYZL1  Malacards: LYZL1 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0050829 |
defense response to Gram- negative bacterium
|
IBA |
biological process |
GO:0050830 |
defense response to Gram- positive bacterium
|
IBA |
biological process |
GO:0003796 |
lysozyme activity
|
IEA |
molecular function |
GO:0016787 |
hydrolase activity
|
IEA |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0008152 |
metabolic process
|
IEA |
biological process |
GO:0016798 |
hydrolase activity, actin g on glycosyl bonds
|
IEA |
molecular function |
GO:0003796 |
lysozyme activity
|
IEA |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
|
|
| Pathway id | Pathway name |
| hsa04970 | Salivary secretion | |
|
| Associated diseases |
References |
| Non obstructive azoospermia | MIK: 24012201 |
| Sertoli cell only syndrome | MIK: 23869807 |
| Spermatogenic defects | MIK: 31037746 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 24012201 |
Non obstru ctive azoo spermia
|
|
|
31 (4 controls, 27 cases)
|
Male infertility |
GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 23869807 |
Non obstru ctive azoo spermia, S ertoli cel l only syn drome
|
|
|
20 (4 controls, 16 cases)
|
Male infertility |
GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
28 men with az oospermia
|
Male infertility |
Microarray
|
Show abstract |
|