• Gene id: 84539

Gene Summary

• Gene Symbol: MCHR2   Gene   UCSC   Ensembl
• Aliases: GPR145, GPRv17, MCH-2R, MCH-R2, MCH2, MCH2R, MCHR-2, SLT
• Gene name: melanin concentrating hormone receptor 2
• Alternate names: melanin-concentrating hormone receptor 2, G protein-coupled receptor slt, G-protein coupled receptor 145, MCH receptor 2, melanin-concentrating hormone 2,
• Gene location: 6q16.2 (99994237: 99918518)     Exons: 6     NC_000006.12
• OMIM: 606111

Protein Summary

• Protein general information: Q969V1  
  • Name: Melanin concentrating hormone receptor 2 (MCH receptor 2) (MCH R2) (MCHR 2) (G protein coupled receptor 145) (GPRv17) (MCH 2R) (MCH2) (MCH2R)
  • Length: 340  
  • Mass: 38849
  • Tissue specificity: Specifically expressed in the brain, with highest levels in cerebral cortex, hippocampus and amygdala. No expression detected in the cerebellum, thalamus or hypothalamus.
• Sequence:

  MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTIIRSRKKTVPDIYICNL
  AVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFACSAIMTVMSVDRYFALVQPFRLTRWRTRYKT
  IRINLGLWAASFILALPVWVYSKVIKFKDGVESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTW
  EMYQQNKDARCCNPSVPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
  INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR008362  IPR008361  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000281806
• Other Databases: GeneCards:  MCHR2  Malacards:  MCHR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)