• Gene id: 84528

Gene Summary

• Gene Symbol: RHOXF2   Gene   UCSC   Ensembl
• Aliases: CT107, PEPP-2, PEPP2, THG1
• Gene name: Rhox homeobox family member 2
• Alternate names: rhox homeobox family member 2, PEPP subfamily gene 2, cancer/testis antigen 107, homeobox protein from AL590526, paired-like homeobox protein PEPP-2, testis homeobox gene 1,
• Gene location: Xq24 (120158534: 120165625)     Exons: 4     NC_000023.11
• Gene summary(Entrez): This gene, which encodes a transcriptional repressor, is one of two paralogous X-linked homeobox-containing genes and is highly expressed in a variety of cancers. In addition, the encoded protein associates with the cell membrane and with microtubules, an
• OMIM: 300447

Protein Summary

• Protein general information: Q9BQY4  
  • Name: Rhox homeobox family member 2 (Paired like homeobox protein PEPP 2) (Testis homeobox gene 1)
  • Length: 288  
  • Mass: 31,692
• Sequence:

  MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGG
  EEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELE
  RIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFI
  SGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000360441
• Other Databases: GeneCards:  RHOXF2  Malacards:  RHOXF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Male factor infertility	MIK: 23943794
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 23943794
Spermatogenic failure	MIK: 25780578

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23943794	Male infertility			Infertile patients	Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25780578	Spermatogenic failure			227 displayed impaired spermatogenesis	Male infertility