• Gene id: 84466

Gene Summary

• Gene Symbol: MEGF10   Gene   UCSC   Ensembl
• Aliases: EMARDD, SR-F3
• Gene name: multiple EGF like domains 10
• Alternate names: multiple epidermal growth factor-like domains protein 10,
• Gene location: 5q23.2 (127229518: 127461221)     Exons: 31     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the multiple epidermal growth factor-like domains protein family. The encoded protein plays a role in cell adhesion, motility and proliferation, and is a critical mediator of apoptotic cell phagocytosis as well as amyloid-bet
• OMIM: 612453

Protein Summary

• Protein general information: Q96KG7  
  • Name: Multiple epidermal growth factor like domains protein 10 (Multiple EGF like domains protein 10)
  • Length: 1140  
  • Mass: 122205
• Sequence:

  MVISLNSCLSFICLLLCHWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRVS
  YRTAYRHGEKTMYRRKSQCCPGFYESGEMCVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCTS
  RCQCKNGALCNPITGACHCAAGFRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLC
  PPGKHGPQCEQRCPCQNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCHCSP
  GYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLYGIKCDKRCPCHLENT
  HSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDSVTGKCTCAPGFKGIDCSTPCPLGTYGI
  NCSSRCGCKNDAVCSPVDGSCTCKAGWHGVDCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKC
  ELPCQDGTYGLNCAERCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
  ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVCPSGRFGKNCAGICTC
  TNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHNGAFCSAYDGECKCTPGWTGLYCTQRCPLGF
  YGKDCALICQCQNGADCDHISGQCTCRTGFMGRHCEQKCPSGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKG
  ARCDQAGVIIVGNLNSLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMR
  VVNADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTVTKSKNNQLFVNLKNVNPGKRGPVGD
  CTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSNCSLSSSENPYATIKDPPVLIPKSSECGYVE
  MKSPARRDSPYAEINNSTSANRNVYEVEPTVSVVQGVFSNNGRLSQDPYDLPKNSHIPCHYDLLPVRDSSSSPKQ
  EDSGGSSSNSSSSSE

• Structural information:
  • Protein Domains: (30..10-)
    (/note="EMI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00384-)
    (106..13-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (144..17-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0007-)
  • Interpro: IPR013032  IPR000742  IPR011489  IPR002049  
  • Prosite: PS00022 PS01186 PS50026 PS51041
  • STRING: ENSP00000274473
• Other Databases: GeneCards:  MEGF10  Malacards:  MEGF10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043277	apoptotic cell clearance	IBA	biological process
GO:0005112	Notch binding	IBA	molecular function
GO:0001891	phagocytic cup	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034109	homotypic cell-cell adhesion	IDA	biological process
GO:0033002	muscle cell proliferation	IMP	biological process
GO:0005112	Notch binding	IPI	molecular function
GO:1902742	apoptotic process involved in development	ISS	biological process
GO:0043652	engulfment of apoptotic cell	ISS	biological process
GO:0048641	regulation of skeletal muscle tissue development	IMP	biological process
GO:0014841	skeletal muscle satellite cell proliferation	ISS	biological process
GO:0014816	skeletal muscle satellite cell differentiation	IMP	biological process
GO:0051451	myoblast migration	IMP	biological process
GO:0055001	muscle cell development	IMP	biological process
GO:0051147	regulation of muscle cell differentiation	IMP	biological process
GO:0014719	skeletal muscle satellite cell activation	ISS	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0001849	complement component C1q complex binding	IDA	molecular function
GO:0005044	scavenger receptor activity	IDA	molecular function
GO:1902742	apoptotic process involved in development	IEA	biological process
GO:0043652	engulfment of apoptotic cell	IEA	biological process
GO:0014841	skeletal muscle satellite cell proliferation	IEA	biological process
GO:0014816	skeletal muscle satellite cell differentiation	IEA	biological process
GO:0005112	Notch binding	IEA	molecular function
GO:0001891	phagocytic cup	IEA	cellular component
GO:2000288	positive regulation of myoblast proliferation	IEA	biological process
GO:0051451	myoblast migration	IEA	biological process
GO:0048627	myoblast development	IEA	biological process
GO:0043654	recognition of apoptotic cell	IEA	biological process
GO:0014719	skeletal muscle satellite cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0001891	phagocytic cup	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:2000288	positive regulation of myoblast proliferation	IMP	biological process
GO:0022409	positive regulation of cell-cell adhesion	IMP	biological process

Diseases

Associated diseases	References
Early-onset myopathy, areflexia, respiratory distress, and dysphagia	KEGG:H02321
Early-onset myopathy, areflexia, respiratory distress, and dysphagia	KEGG:H02321
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881