• Gene id: 84458

Gene Summary

• Gene Symbol: LCOR   Gene   UCSC   Ensembl
• Aliases: C10orf12, MLR2
• Gene name: ligand dependent nuclear receptor corepressor
• Alternate names: ligand-dependent corepressor, mblk1-related protein 2,
• Gene location: 10q24.1 (96832297: 96995955)     Exons: 10     NC_000010.11
• Gene summary(Entrez): LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528])
• OMIM: 607698

Protein Summary

• Protein general information: Q96JN0  
  • Name: Ligand dependent corepressor (LCoR) (Mblk1 related protein 2)
  • Length: 433  
  • Mass: 47007
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSE
  PSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLK
  VPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLA
  ENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQS
  RKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIY
  GIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQGEAAQSANESKNE

• Structural information:
  • Protein Domains: (340..39-)
    (/note="HTH-psq-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00320"-)
  • Interpro: IPR009057  IPR007889  
  • Prosite: PS50960
  • PDB: 2COB
  • PDBsum: 2COB
  • STRING: ENSP00000360138
• Other Databases: GeneCards:  LCOR  Malacards:  LCOR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq