• Gene id: 84437

Gene Summary

• Gene Symbol: MSANTD4   Gene   UCSC   Ensembl
• Aliases: KIAA1826
• Gene name: Myb/SANT DNA binding domain containing 4 with coiled-coils
• Alternate names: myb/SANT-like DNA-binding domain-containing protein 4, Myb/SANT-like DNA-binding domain containing 4 with coiled-coils,
• Gene location: 11q22.3 (106022286: 106007898)     Exons: 5     NC_000011.10
• OMIM: 0

Protein Summary

• Protein general information: Q8NCY6  
  • Name: Myb/SANT like DNA binding domain containing protein 4 (Myb/SANT like DNA binding domain containing 4 with coiled coils)
  • Length: 345  
  • Mass: 41150
• Sequence:

  MKQLKRKRKSNFSVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLD
  WRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRNDANFDWQNVADFRDAGGSLTEVKVEEEERDP
  QSPEFEIEEEEEMLSSVIPDSRRENELPDFPHIDEFFTLNSTPSRSAYDEPHLLVNIEKQKLELEKRRLDIEAER
  LQVEKERLQIEKERLRHLDMEHERLQLEKERLQIEREKLRLQIVNSEKPSLENELGQGEKSMLQPQDIETEKLKL
  ERERLQLEKDRLQFLKFESEKLQIEKERLQVEKDRLRIQKEGHLQ

• Structural information:
  • Protein Domains: (4..7-)
    (/note="Myb-like"-)
  • Interpro: IPR026162  IPR028002  
  • STRING: ENSP00000304713
• Other Databases: GeneCards:  MSANTD4  Malacards:  MSANTD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)