• Gene id: 84435

Gene Summary

• Gene Symbol: ADGRA1   Gene   UCSC   Ensembl
• Aliases: GPR123
• Gene name: adhesion G protein-coupled receptor A1
• Alternate names: adhesion G protein-coupled receptor A1, G-protein coupled receptor 123, probable G-protein coupled receptor 123,
• Gene location: 10q26.3 (133087923: 133131674)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein that belongs to the adhesion family of G-protein-coupled receptors. Members of this family function in several sensory systems and regulate blood pressure, immune responses, food intake and development. A similar protein in rod
• OMIM: 606474

Protein Summary

• Protein general information: Q86SQ6  
  • Name: Adhesion G protein coupled receptor A1 (G protein coupled receptor 123)
  • Length: 560  
  • Mass: 60885
• Sequence:

  MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFCFHAALTFTVFAGGIN
  RTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCLDTDQPPYPRQPLLRFYLVSGGVPFIICGVT
  AATNIRNYGTEDEDTAYCWMAWEPSLGAFYGPAAIITLVTCVYFLGTYVQLRRHPGRRYELRTQPEEQRRLATPE
  GGRGIRPGTPPAHDAPGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQGHFLDMVFSCLYGAFCVTLGL
  FVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLGQPRGFAHPPGPCKMTNLQAAQGHAS
  CLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGRTKPPYFSRHPAEEPEYAYHIPSSLDGSPRS
  SRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGSDGSPALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGP
  SQNGLPKGKLLEGLPFGTDGTGNIRTGPWKNETTV

• Structural information:
  • Interpro: IPR017981  IPR000832  IPR017983  
  • Prosite: PS00650 PS50261
  • STRING: ENSP00000376384
• Other Databases: GeneCards:  ADGRA1  Malacards:  ADGRA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0004930	G protein-coupled receptor activity	NAS	molecular function
GO:0004930	G protein-coupled receptor activity	NAS	molecular function
GO:0007165	signal transduction	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray