• Gene id: 84376

Gene Summary

• Gene Symbol: HOOK3   Gene   UCSC   Ensembl
• Aliases: HK3
• Gene name: hook microtubule tethering protein 3
• Alternate names: protein Hook homolog 3, h-hook3, hHK3, hook homolog 3,
• Gene location: 8p11.21 (46458890: 46571225)     Exons: 42     NC_000021.9
• Gene summary(Entrez): Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocyt
• OMIM: 607825

Protein Summary

• Protein general information: Q86VS8  
  • Name: Protein Hook homolog 3 (h hook3) (hHK3)
  • Length: 718  
  • Mass: 83126
• Sequence:

  MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNRIKTEVGDNWRLKISN
  LKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVV
  MTAIQELMSKESPVSAGNDAYVDLDRQLKKTTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLME
  RLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLK
  DEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANAARSQLETYKRQV
  VELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRLRTERDSLKETIEELRCVQAQEGQLTTQGLMPLGSQES
  SDSLAAEIVTPEIREKLIRLQHENKMLKLNQEGSDNEKIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVE
  ELQKSLQDQGSKAEDSVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQM
  EERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREMEEKYIVSAWYNMGMT
  LHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATAR

• Structural information:
  • Protein Domains: (10..12-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044"-)
  • Interpro: IPR001715  IPR036872  IPR008636  
  • Prosite: PS50021
  • PDB: 5J8E 6B9H
  • PDBsum: 5J8E 6B9H
  • STRING: ENSP00000305699
• Other Databases: GeneCards:  HOOK3  Malacards:  HOOK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0030705	cytoskeleton-dependent intracellular transport	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0005813	centrosome	IBA	cellular component
GO:0051959	dynein light intermediate chain binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0045505	dynein intermediate chain binding	IDA	molecular function
GO:0070695	FHF complex	IDA	cellular component
GO:0030897	HOPS complex	IDA	colocalizes with
GO:0034452	dynactin binding	IDA	molecular function
GO:0008333	endosome to lysosome transport	IMP	biological process
GO:0007040	lysosome organization	IMP	biological process
GO:0007032	endosome organization	IMP	biological process
GO:0045503	dynein light chain binding	IPI	molecular function
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000242	pericentriolar material	IEA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0034454	microtubule anchoring at centrosome	IEA	biological process
GO:0050768	negative regulation of neurogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0022027	interkinetic nuclear migration	IEA	biological process
GO:0034451	centriolar satellite	IEA	cellular component
GO:0071539	protein localization to centrosome	IEA	biological process
GO:0097150	neuronal stem cell population maintenance	IEA	biological process
GO:0000242	pericentriolar material	ISS	cellular component
GO:0005813	centrosome	ISS	cellular component
GO:0034454	microtubule anchoring at centrosome	ISS	biological process
GO:0050768	negative regulation of neurogenesis	ISS	biological process
GO:0022027	interkinetic nuclear migration	ISS	biological process
GO:0071539	protein localization to centrosome	ISS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0051645	Golgi localization	IMP	biological process
GO:0031122	cytoplasmic microtubule organization	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray