|
Gene id |
84366 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
PRAC1 Gene UCSC Ensembl |
|
Aliases |
C17orf92, PRAC |
|
Gene name |
PRAC1 small nuclear protein |
|
Alternate names |
small nuclear protein PRAC1, prostate cancer susceptibility candidate 1, prostate cancer susceptibility candidate protein 1, prostate, rectum and colon expressed gene protein, small nuclear protein PRAC, |
|
Gene location |
17q21.32 (26223084: 26132114) Exons: 10 NC_000013.11
|
|
Gene summary(Entrez) |
This gene is reported to be specifically expressed in prostate, rectum and distal colon. Sequence analysis suggests that it may play a regulatory role in the nucleus. [provided by RefSeq, Jul 2008]
|
|
OMIM |
609819 |
Protein Summary
|
| Protein general information
| Q96KF2
Name: Small nuclear protein PRAC1 (Prostate cancer susceptibility candidate protein 1) (Prostate, rectum and colon expressed gene protein)
Length: 57 Mass: 5959
Tissue specificity: Highly expressed in prostate, rectum, and distal colon, and weakly expressed in bladder. Expressed in prostate cancer cell lines. {ECO
|
| Sequence |
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
|
| Structural information |
|
| Other Databases |
GeneCards: PRAC1  Malacards: PRAC1 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0005654 |
nucleoplasm
|
IDA |
cellular component |
GO:0005829 |
cytosol
|
IDA |
cellular component |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|