• Gene id: 8436

Gene Summary

• Gene Symbol: CAVIN2   Gene   UCSC   Ensembl
• Aliases: PS-p68, SDPR, SDR, cavin-2
• Gene name: caveolae associated protein 2
• Alternate names: caveolae-associated protein 2, phosphatidylserine-binding protein, serum deprivation response, serum deprivation-response protein,
• Gene location: 2q32.3 (191847087: 191834309)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene encodes a calcium-independent phospholipid-binding protein whose expression increases in serum-starved cells. This protein is a substrate for protein kinase C (PKC) phosphorylation and recruits polymerase I and transcript release factor (PTRF) t
• OMIM: 176847

Protein Summary

• Protein general information: O95810  
  • Name: Caveolae associated protein 2 (Cavin 2) (PS p68) (Phosphatidylserine binding protein) (Serum deprivation response protein)
  • Length: 425  
  • Mass: 47173
  • Tissue specificity: Highly expressed in heart and lung, and expressed at lower levels in brain, kidney, liver, pancreas, placenta, and skeletal muscle. {ECO
• Sequence:

  MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQEN
  QHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLL
  RRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEE
  SRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK
  KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKATSRGSNSGMDSNIDLT
  IVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQVHQTS

• Structural information:
  • Interpro: IPR033298  IPR026752  
  • DIP: 56943
  • STRING: ENSP00000305675
• Other Databases: GeneCards:  CAVIN2  Malacards:  CAVIN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005901	caveola	IBA	cellular component
GO:0005080	protein kinase C binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0097320	plasma membrane tubulation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005543	phospholipid binding	TAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R