• Gene id: 8433

Gene Summary

• Gene Symbol: UTF1   Gene   UCSC   Ensembl
• Gene name: undifferentiated embryonic cell transcription factor 1
• Alternate names: undifferentiated embryonic cell transcription factor 1,
• Gene location: 10q26.3 (133230216: 133231557)     Exons: 2     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a leucine zipper-containing transcriptional coactivator that may link the upstream activator ATF2 with the basal transcription complex. The encoded protein is closely associated with chromatin and is required for the pr
• OMIM: 604130

Protein Summary

• Protein general information: Q5T230  
  • Name: Undifferentiated embryonic cell transcription factor 1
  • Length: 341  
  • Mass: 36439
• Sequence:

  MLLRPRRPPPLAPPAPPSPASPDPEPRTPGDAPGTPPRRPASPSALGELGLPVSPGSAQRTPWSARETELLLGTL
  LQPAVWRALLLDRRQALPTYRRVSAALAQQQVRRTPAQCRRRYKFLKDKFREAHGQPPGPFDEQIRKLMGLLGDN
  GRKRPRRRSPGSGRPQRARRPVPNAHAPAPSEPDATPLPTARDRDADPTWTLRFSPSPPKSADASPAPGSPPAPA
  PTALATCIPEDRAPVRGPGSPPPPPAREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL
  LTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVLRDPCQ

• Structural information:
  • STRING: ENSP00000305906
• Other Databases: GeneCards:  UTF1  Malacards:  UTF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IC	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008584	male gonad development	IEP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)