Search Result
| Gene id | 84328 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | LZIC Gene UCSC Ensembl | ||||||||||||||||||||||||
| Gene name | leucine zipper and CTNNBIP1 domain containing | ||||||||||||||||||||||||
| Alternate names | protein LZIC, leucine zipper and CTNNBIP1 domain-containing protein, leucine zipper and ICAT homologous domain-containing protein, leucine zipper domain and ICAT homologous domain containing, | ||||||||||||||||||||||||
| Gene location |
1p36.22 (9943401: 9922117) Exons: 10 NC_000001.11 |
||||||||||||||||||||||||
| OMIM | 610458 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q8WZA0 Name: Protein LZIC (Leucine zipper and CTNNBIP1 domain containing protein) (Leucine zipper and ICAT homologous domain containing protein) Length: 190 Mass: 21495 Tissue specificity: Ubiquitously expressed, with highest levels in kidney. Up-regulated in several cases of gastric cancers. {ECO | ||||||||||||||||||||||||
| Sequence |
MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELS GMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDE AFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: LZIC  Malacards: LZIC | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||