• Gene id: 84316

Gene Summary

• Gene Symbol: NAA38   Gene   UCSC   Ensembl
• Aliases: LSMD1, MAK31, PFAAP2
• Gene name: N-alpha-acetyltransferase 38, NatC auxiliary subunit
• Alternate names: N-alpha-acetyltransferase 38, NatC auxiliary subunit, LSM domain containing 1, LSM domain-containing protein 1, phosphonoformate immuno-associated protein 2,
• Gene location: 17p13.1 (7885419: 7856680)     Exons: 6     NC_000017.11
• OMIM: 611241

Protein Summary

• Protein general information: Q9BRA0  
  • Name: N alpha acetyltransferase 38, NatC auxiliary subunit (LSM domain containing protein 1) (Phosphonoformate immuno associated protein 2)
  • Length: 125  
  • Mass: 13514
• Sequence:

  MAGAGPTMLLREENGCCSRRQSSSSAGDSDGEREDSAAERARQQLEALLNKTMRIRMTDGRTLVGCFLCTDRDCN
  VILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLTGPPYL

• Structural information:
  • Interpro: IPR001163  IPR010920  IPR034110  
  • CDD: cd06168
  • STRING: ENSP00000332103
• Other Databases: GeneCards:  NAA38  Malacards:  NAA38

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031417	NatC complex	IDA	cellular component
GO:0005844	polysome	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0031417	NatC complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray