• Gene id: 84286

Gene Summary

• Gene Symbol: TMEM175   Gene   UCSC   Ensembl
• Aliases: hTMEM175
• Gene name: transmembrane protein 175
• Alternate names: endosomal/lysosomal potassium channel TMEM175, endosomal/lysomomal potassium channel TMEM175,
• Gene location: 4p16.3 (932386: 958655)     Exons: 15     NC_000004.12

Protein Summary

• Protein general information: Q9BSA9  
  • Name: Endosomal/lysosomal potassium channel TMEM175 (Transmembrane protein 175) (hTMEM175)
  • Length: 504  
  • Mass: 55615
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLA
  TRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAI
  GVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSK
  VTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
  AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELER
  VRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHL
  MQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC

• Structural information:
  • Interpro: IPR010617  
  • STRING: ENSP00000264771
• Other Databases: GeneCards:  TMEM175  Malacards:  TMEM175

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0022841	potassium ion leak channel activity	IDA	molecular function
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0022841	potassium ion leak channel activity	IEA	molecular function
GO:0035751	regulation of lysosomal lumen pH	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0090385	phagosome-lysosome fusion	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq