• Gene id: 84274

Gene Summary

• Gene Symbol: COQ5   Gene   UCSC   Ensembl
• Gene name: coenzyme Q5, methyltransferase
• Alternate names: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial, coenzyme Q5 homolog, methyltransferase, ubiquinone biosynthesis methyltransferase COQ5, mitochondrial,
• Gene location: 12q24.31 (120534612: 120503278)     Exons: 35     NC_000012.12
• OMIM: 616359

Protein Summary

• Protein general information: Q5HYK3  
  • Name: 2 methoxy 6 polyprenyl 1,4 benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5)
  • Length: 327  
  • Mass: 37140
  • Tissue specificity: Widely expressed, with highest levels in liver, lung, placenta and skeletal muscle. {ECO
• Sequence:

  MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESV
  AKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEE
  IAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHI
  DQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDM
  IEDAGFHKVTYESLTSGIVAIHSGFKL

• Structural information:
  • Interpro: IPR029063  IPR004033  IPR023576  
  • Prosite: PS51608 PS01183 PS01184
  • STRING: ENSP00000288532
• Other Databases: GeneCards:  COQ5  Malacards:  COQ5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0006744	ubiquinone biosynthetic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0006744	ubiquinone biosynthetic process	IEA	biological process
GO:0043333	2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0031314	extrinsic component of mitochondrial inner membrane	IEA	cellular component
GO:0006744	ubiquinone biosynthetic process	IEA	biological process
GO:0043430	2-decaprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity	IEA	molecular function
GO:0006744	ubiquinone biosynthetic process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IDA	colocalizes with
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0043333	2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity	IDA	molecular function
GO:0032259	methylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006744	ubiquinone biosynthetic process	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00130	Ubiquinone and other terpenoid-quinone biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)