Search Result
| Gene id | 84270 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CARD19 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | BinCARD, C9orf89 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | caspase recruitment domain family member 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | caspase recruitment domain-containing protein 19, Bcl10-interacting protein with CARD, bcl10-interacting CARD protein, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
9q22.31 (93096216: 93113282) Exons: 7 NC_000009.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 617726 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q96LW7 Name: Caspase recruitment domain containing protein 19 (Bcl10 interacting CARD protein) (BinCARD) Length: 228 Mass: 25589 Tissue specificity: Expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart and liver (at protein level). Expressed in thymus and brain. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGER DCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPP QRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRGSLHVCVDSNLVPTAA WRS | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CARD19  Malacards: CARD19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||