• Gene id: 84258

Gene Summary

• Gene Symbol: SYT3   Gene   UCSC   Ensembl
• Aliases: SytIII
• Gene name: synaptotagmin 3
• Alternate names: synaptotagmin-3, synaptotagmin III,
• Gene location: 19q13.33 (50639880: 50621976)     Exons: 11     NC_000019.10
• OMIM: 604710

Protein Summary

• Protein general information: Q9BQG1  
  • Name: Synaptotagmin 3 (Synaptotagmin III) (SytIII)
  • Length: 590  
  • Mass: 63304
  • Tissue specificity: Expressed in melanocytes (PubMed
• Sequence:

  MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNDRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVS
  WKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGS
  LGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTR
  YPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPC
  GRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLA
  ELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADLGELNFSLCYLPTAGRLTV
  TIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDC
  IGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQLVEEKTVTSFTKGSKGLSEKENSE

• Structural information:
  • Protein Domains: (299..42-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (431..56-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR001565  IPR028682  
  • Prosite: PS50004
  • STRING: ENSP00000340914
• Other Databases: GeneCards:  SYT3  Malacards:  SYT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005544	calcium-dependent phospholipid binding	NAS	molecular function
GO:0000149	SNARE binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0019905	syntaxin binding	IBA	molecular function
GO:0030276	clathrin binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IBA	biological process
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:1903861	positive regulation of dendrite extension	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq