• Gene id: 84255

Gene Summary

• Gene Symbol: SLC37A3   Gene   UCSC   Ensembl
• Gene name: solute carrier family 37 member 3
• Alternate names: sugar phosphate exchanger 3, solute carrier family 37 (glycerol-3-phosphate transporter), member 3,
• Gene location: 7q34 (140398549: 140333751)     Exons: 10     NC_000007.14

Protein Summary

• Protein general information: Q8NCC5  
  • Name: Sugar phosphate exchanger 3 (Solute carrier family 37 member 3)
  • Length: 494  
  • Mass: 54486
  • Tissue specificity: Expressed in liver, kidney, intestine and pancreas. {ECO
• Sequence:

  MAWPNVFQRGSLLSQFSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFP
  SAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYNKWLYCCLWIV
  NGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIVIFF
  GLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYA
  CLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLLLAVGSLIGYS
  RSPNDKSINALLMTVTGFFIGGPSNMISSAISADLGRQELIQRSSEALATVTGIVDGSGSIGAAVGQYLVSLIRD
  KLGWMWVFYFFILMTSCTIVFISPLIVREIFSLVLRRQAHILRE

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR000849  
  • Prosite: PS50850
  • STRING: ENSP00000321498
• Other Databases: GeneCards:  SLC37A3  Malacards:  SLC37A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	IDA	NOT|molecular function
GO:0015760	glucose-6-phosphate transport	IDA	NOT|biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0035435	phosphate ion transmembrane transport	IDA	NOT|biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0015711	organic anion transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881