• Gene id: 8412

Gene Summary

• Gene Symbol: BCAR3   Gene   UCSC   Ensembl
• Aliases: AND-34, NSP2, SH2D3B
• Gene name: BCAR3 adaptor protein, NSP family member
• Alternate names: breast cancer anti-estrogen resistance protein 3, BCAR3, NSP family adaptor protein, SH2 domain-containing protein 3B, breast cancer anti-estrogen resistance 3, breast cancer antiestrogen resistance 3 protein, dJ1033H22.2 (breast cancer anti-estrogen resistanc,
• Gene location: 1p22.1 (93847218: 93561740)     Exons: 19     NC_000001.11
• Gene summary(Entrez): Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was i
• OMIM: 618319

Protein Summary

• Protein general information: O75815  
  • Name: Breast cancer anti estrogen resistance protein 3 (Novel SH2 containing protein 2) (SH2 domain containing protein 3B)
  • Length: 825  
  • Mass: 92566
  • Tissue specificity: Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue. {ECO
• Sequence:

  MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPH
  SKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKELEEELLLSSEDLR
  SHAWYHGRIPRQVSENLVQRDGDFLVRDSLSSPGNFVLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFD
  SIPGLVRCYVGNRRPISQQSGAIIFQPINRTVPLRCLEEHYGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQARE
  QNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPALS
  PAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKVPFLKVPSSPSAWLNSEANYCELNPAFATGCGRGAKLPSCA
  QGSHTELLTAKQNEAPGPRNSGVNYLILDDDDRERPWEPAAAQMEKGQWDKGEFVTPLLETVSSFRPNEFESKFL
  PPENKPLETAMLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIE
  RHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQ
  TAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFM
  AEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL

• Structural information:
  • Protein Domains: (154..25-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (548..81-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168"-)
  • Interpro: IPR028849  IPR023578  IPR001895  IPR036964  IPR000980   IPR036860  
  • Prosite: PS50009 PS50001
  • CDD: cd00155
  • PDB: 3T6A
  • PDBsum: 3T6A
  • DIP: 33857
  • STRING: ENSP00000359264
• Other Databases: GeneCards:  BCAR3  Malacards:  BCAR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0042493	response to drug	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0002089	lens morphogenesis in camera-type eye	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0008286	insulin receptor signaling pathway	IMP	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0001784	phosphotyrosine residue binding	IMP	molecular function
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0086100	endothelin receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043410	positive regulation of MAPK cascade	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881