• Gene id: 8406

Gene Summary

• Gene Symbol: SRPX   Gene   UCSC   Ensembl
• Aliases: DRS, ETX1, HEL-S-83p, SRPX1
• Gene name: sushi repeat containing protein X-linked
• Alternate names: sushi repeat-containing protein SRPX, epididymis secretory sperm binding protein Li 83p, sushi-repeat-containing protein, X chromosome,
• Gene location: Xp11.4 (38220923: 38149334)     Exons: 10     NC_000023.11
• OMIM: 300187

Protein Summary

• Protein general information: P78539  
  • Name: Sushi repeat containing protein SRPX
  • Length: 464  
  • Mass: 51572
  • Tissue specificity: Retina and heart; less in placenta, pancreas, lung, liver, skeletal muscle, kidney and brain.
• Sequence:

  MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGG
  YYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPG
  YTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLP
  PGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSP
  ARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHIT
  VVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKE
  EMVLQAEMSQTCNT

• Structural information:
  • Protein Domains: (57..11-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (118..17-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (177..25-)
    (/note="HYR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00113-)
    (-)
  • Interpro: IPR025232  IPR003410  IPR036981  IPR035976  IPR000436  
  • Prosite: PS50825 PS50923
  • CDD: cd00033
  • STRING: ENSP00000367794
• Other Databases: GeneCards:  SRPX  Malacards:  SRPX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0060244	negative regulation of cell proliferation involved in contact inhibition	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001845	phagolysosome assembly	IEA	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0009986	cell surface	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)