• Gene id: 83999

Gene Summary

• Gene Symbol: KREMEN1   Gene   UCSC   Ensembl
• Aliases: ECTD13, KREMEN, KRM1
• Gene name: kringle containing transmembrane protein 1
• Alternate names: kremen protein 1, dickkopf receptor, kringle domain-containing transmembrane protein 1, kringle-coding gene marking the eye and the nose, kringle-containing protein marking the eye and the nose,
• Gene location: 22q12.1 (29073034: 29168332)     Exons: 12     NC_000022.11
• Gene summary(Entrez): This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT
• OMIM: 609898

Protein Summary

• Protein general information: Q96MU8  
  • Name: Kremen protein 1 (Dickkopf receptor) (Kringle domain containing transmembrane protein 1) (Kringle containing protein marking the eye and the nose)
  • Length: 473  
  • Mass: 51744
• Sequence:

  MAPPAARLALLSAAALTLAARPAPSPGLGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGE
  GGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISF
  CRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVV
  YSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVI
  LYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSN
  SWAPPMGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTS
  ISIFKKKLKGQSQQDDRNPLVSD

• Structural information:
  • Protein Domains: (31..11-)
    (/note="Kringle-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00121-)
    (116..21-)
    (/note="WSC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00558-)
    (214..32-)
    (/note="CUB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059"-)
  • Interpro: IPR000859  IPR017076  IPR000001  IPR013806  IPR018056   IPR038178  IPR035914  IPR002889  
  • Prosite: PS01180 PS00021 PS50070 PS51212
  • CDD: cd00041 cd00108
  • PDB: 5FWS 5FWT 5FWU 5FWV 5FWW
  • PDBsum: 5FWS 5FWT 5FWU 5FWV 5FWW
  • DIP: 46462
  • STRING: ENSP00000331242
• Other Databases: GeneCards:  KREMEN1  Malacards:  KREMEN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0060173	limb development	ISS	biological process
GO:0006915	apoptotic process	ISS	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030279	negative regulation of ossification	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060828	regulation of canonical Wnt signaling pathway	NAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0007154	cell communication	TAS	biological process

Diseases

Associated diseases	References
Ectodermal dysplasia, hair-nail type	KEGG:H00649
Ectodermal dysplasia, hair-nail type	KEGG:H00649
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq