• Gene id: 83953

Gene Summary

• Gene Symbol: FCAMR   Gene   UCSC   Ensembl
• Aliases: CD351, FCA/MR, FKSG87
• Gene name: Fc fragment of IgA and IgM receptor
• Alternate names: high affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, Fc alpha/mu receptor, Fc receptor, IgA, IgM, high affinity, immunity related factor, receptor for Fc fragment of IgA and IgM,
• Gene location: 1q32.1 (206970656: 206957954)     Exons: 10     NC_000001.11
• OMIM: 605484

Protein Summary

• Protein general information: Q8WWV6  
  • Name: High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (Fc alpha/mu receptor) (CD antigen CD351)
  • Length: 532  
  • Mass: 57144
  • Tissue specificity: Expressed by mesangial cells. {ECO
• Sequence:

  MPLFLILCLLQGSSFALPQKRPHPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLVSGEPG
  GAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC
  YLCGIGSENNMLFLSMNLTISAGPASTLPTATPAAGELTMRSYGTASPVANRWTPGTTQTLGQGTAWDTVASTPG
  TSKTTASAEGRRTPGATRPAAPGTGSWAEGSVKAPAPIPESPPSKSRSMSNTTEGVWEGTRSSVTNRARASKDRR
  EMTTTKADRPREDIEGVRIALDAAKKVLGTIGPPALVSETLAWEILPQATPVSKQQSQGSIGETTPAAGMWTLGT
  PAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATGDRGPQATLSQTPAVGPWGPPGKESSVKRTFPEDESSSR
  TLAPVSTMLALFMLMALVLLQRKLWRRRTSQEAERVTLIQMTHFLEVNPQADQLPHVERKMLQDDSLPAGASLTA
  PERNPGP

• Structural information:
  • Protein Domains: (61..16-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000316491
• Other Databases: GeneCards:  FCAMR  Malacards:  FCAMR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)