Search Result
| Gene id | 83938 | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
| Gene Symbol | LRMDA Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
| Aliases | C10orf11, CDA017 | ||||||||||||||||||||||||||||||||
| Gene name | leucine rich melanocyte differentiation associated | ||||||||||||||||||||||||||||||||
| Alternate names | leucine-rich melanocyte differentiation-associated protein, leucine-rich repeat-containing protein C10orf11, | ||||||||||||||||||||||||||||||||
| Gene location |
10q22.2-q22.3 (75431623: 76560167) Exons: 11 NC_000010.11 |
||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a leucine-rich repeat protein. The encoded protein is thought to play a role in melanocyte differentiation. Mutations in this gene have been associated with autosomal recessive oculocutaneous albinism 7 (OCA7). Alternatively spliced tran |
||||||||||||||||||||||||||||||||
| OMIM | 617462 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
| Protein general information | Q9H2I8 Name: Leucine rich melanocyte differentiation associated protein Length: 198 Mass: 22568 Tissue specificity: In the embryo, expressed in melanoblasts. In the fetus, expressed in melanocytes. Not detected in retinal pigment epithelial cells. {ECO | ||||||||||||||||||||||||||||||||
| Sequence |
MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPA LEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDV ASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL | ||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: LRMDA  Malacards: LRMDA | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||