• Gene id: 8390

Gene Summary

• Gene Symbol: OR1G1   Gene   UCSC   Ensembl
• Aliases: OR17-130, OR17-209, OR1G2
• Gene name: olfactory receptor family 1 subfamily G member 1
• Alternate names: olfactory receptor 1G1, olfactory receptor 17-209, olfactory receptor 1G2, olfactory receptor OR17-8, olfactory receptor, family 1, subfamily G, member 2,
• Gene location: 17p13.3 (91732085: 91580697)     Exons: 27     NC_000014.9
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Protein Summary

• Protein general information: P47890  
  • Name: Olfactory receptor 1G1 (Olfactory receptor 17 209) (OR17 209) (Olfactory receptor 1G2) (Olfactory receptor OR17 8)
  • Length: 313  
  • Mass: 34924
• Sequence:

  MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMYFFLANLSLADACFVS
  TTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAYDCYVAICHPLHYILIMSPGLCIFLVSASWI
  MNALHSLLHTLLMNSLSFCANHEIPHFFCDINPLLSLSCTDPFTNELVIFITGGLTGLICVLCLIISYTNVFSTI
  LKIPSAQGKRKAFSTCSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSS
  LRKLIWVRKIHSP

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS50262
  • STRING: ENSP00000331545
• Other Databases: GeneCards:  OR1G1  Malacards:  OR1G1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq