• Gene id: 83894

Gene Summary

• Gene Symbol: TTC29   Gene   UCSC   Ensembl
• Aliases: NYD-SP14, SPGF42, TBPP2A
• Gene name: tetratricopeptide repeat domain 29
• Alternate names: tetratricopeptide repeat protein 29, TPR repeat protein 29, testicular secretory protein Li 62, testis development protein NYD-SP14,
• Gene location: 4q31.22 (146945885: 146706637)     Exons: 17     NC_000004.12
• OMIM: 618735

Protein Summary

• Protein general information: Q8NA56  
  • Name: Tetratricopeptide repeat protein 29 (TPR repeat protein 29) (Protein TBPP2A) (Testis development protein NYD SP14)
  • Length: 475  
  • Mass: 55082
• Sequence:

  MTTLPPLPMTRPKLTALARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKNICVDMLRD
  GYHKSFTELFALMERWDALREAARVRSLFWLQKPLEEQPDKLDYLYHYLTRAEDAERKESFEDVHNNLYALACYF
  NNSEDKWVRNHFYERCFKIAQLIKIDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSL
  NLLACESLLRTYRLLSDKMLENKEYKQAIKILIKASEIAKEGSDKKMEAEASYYLGLAHLAAEEYETALTVLDTY
  CKISTDLDDDLSLGRGYEAIAKVLQSQGEMTEAIKYLKKFVKIARNNFQSLDLVRASTMLGDIYNEKGYYNKASE
  CFQQAFDTTVELMSMPLMDETKVHYGIAKAHQMMLTVNNYIESADLTSLNYLLSWKESRGNIEPDPVTEEFRGST
  VEAVSQNSERLEELSRFPGDQKNET

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR019734  
  • Prosite: PS50293
  • STRING: ENSP00000423505
• Other Databases: GeneCards:  TTC29  Malacards:  TTC29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044782	cilium organization	IDA	biological process
GO:0003341	cilium movement	IDA	biological process
GO:0036126	sperm flagellum	IDA	cellular component
GO:0044782	cilium organization	IDA	biological process
GO:0003341	cilium movement	IMP	biological process
GO:0036126	sperm flagellum	IMP	cellular component

Diseases

Associated diseases	References
Morphological abnormalities of the sperm flagellum (MMAF)	MIK: 31735292
Asthenozoospermia	MIK: 31735292
Male Infertility	MIK: 31735292
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31735292	Morphological abnormalities of the sperm flagellum (MMAF), Asthenozoospermia and Male Infertility	c.1761 þ G>A, c.330_334delGGAGG, c.750C>A	83 indi viduals origin ated fr om Nort h Afric a (main ly from Algeri a, Liby a, and Tunisia ), 52 i ndividu als ori ginated from t he Midd le East (Iran) , 32 in dividua ls were recrui ted in France	167 men affected by primary infertility associated with a MMAF	Male infertility	NGS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)