• Gene id: 83893

Gene Summary

• Gene Symbol: SPATA16   Gene   UCSC   Ensembl
• Aliases: NYD-SP12, SPGF6
• Gene name: spermatogenesis associated 16
• Alternate names: spermatogenesis-associated protein 16, testicular tissue protein Li 185, testis development protein NYD-SP12, testis-specific Golgi protein,
• Gene location: 3q26.31 (173141267: 172889356)     Exons: 13     NC_000003.12
• Gene summary(Entrez): This gene encodes a testis-specific protein that belongs to the tetratricopeptide repeat-like superfamily. The encoded protein localizes to the Golgi apparatus and may play a role in spermatogenesis. [provided by RefSeq, May 2010]
• OMIM: 609856

Protein Summary

• Protein general information: Q9BXB7  
  • Name: Spermatogenesis associated protein 16 (Testis development protein NYD SP12)
  • Length: 569  
  • Mass: 65,263
• Sequence:

  MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKNCGGKQVEITLERTKMTKGIKEKQSN
  DLEKAAFKRKAEGEEKPTRKKQAKITELDNQLITMPLPHIPLKNIMDVEMKLVYIDEMGVRYEFVESFMSTGSQP
  TCQAAEIVDPLSVHNFSFLPQIDKWLQVALKDASSCYRQKKYALAAGQFRTALELCSKGAVLGEPFDAPAEDIAS
  VASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQATVFRCLERYSEAARSAMIADYMFWLGGGREE
  SISKLIKLYWQAMIEEAITRAESFSVMYTPFATKIRADKIEKVKDAFTKTHPAYAEYMYTDLQALHMLPQTVDWS
  SFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEHKTPFGLTREDTVRQMETMGKRILPILDFIRSTQLNGSFP
  ASSGVMEKLQYASLLSQLQRVKEQSQVINQAMAELATIPYLQDISQQEAELLQSLMADAMDTLEGRRNNNERVWN
  MIQKVGQIEDFLYQLEDSFLKTKKLRTARRQKTKMKRLQTVQQR

• Structural information:
  • Interpro: IPR029161  IPR011990  
  • STRING: ENSP00000341765
• Other Databases: GeneCards:  SPATA16  Malacards:  SPATA16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 22219177
Cancer	GAD: 22219177
Spermatogenesis defects	MIK: 12529416
Spermatogenesis defects	MIK: 12529416
Sertoli cell only syndrome (SCOS)	MIK: 12529416
Globozoospermia	MIK: 24825417
Spermatogenesis defects	OMIM: 609856
Male infertility	MIK: 17847006
Spermatogenic defects	MIK: 30358834
Globozoospermia	MIK: 18547510
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Sertoli cell-only syndrome	MIK: 12529416
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12529416	Spermatogenic arrest, Sertoli cell-only syndrome				Male infertility
24825417	Globozoospermia	SPATA16 mutation		1 globozoospermia	Male infertility
21397063	Globozoospermia	DPY19L2 deletion			Male infertility	DPY19L2 SPATA16 PICK1
18547510	Globozoospermia				Male infertility	SPATA16
17847006	Assocaited with male infertility in human globozoospermia			3 brothers	Male infertility
29065458	Spermatogenic arrest, Male infertility	848G?A/R283Q			Male infertility
27918162	Important for Spermatogenesis, Male infertility	1526C>T + 1577T>C		107 patients with infertility (Gene responsible for mutation in 2 of the patients)	Male infertility
30358834	Associated with spermatogenesis, Male infertility			64 (38 oligo-/oligoastheno-zoospermic infertile patients, 26 normozoospermic fertile men)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
27086357	Globozoospermia	deletion of 22.6 Kb			Male infertility