• Gene id: 83892

Gene Summary

• Gene Symbol: KCTD10   Gene   UCSC   Ensembl
• Aliases: BTBD28, MSTP028, ULRO61, hBACURD3
• Gene name: potassium channel tetramerization domain containing 10
• Alternate names: BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3, BTB/POZ domain-containing protein KCTD10, potassium channel tetramerisation domain containing 10, potassium channel tetramerization domain-containing protein 10,
• Gene location: 12q24.11 (109477299: 109448654)     Exons: 7     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcr
• OMIM: 616755

Protein Summary

• Protein general information: Q9H3F6  
  • Name: BTB/POZ domain containing adapter for CUL3 mediated RhoA degradation protein 3 (hBACURD3) (BTB/POZ domain containing protein KCTD10) (Potassium channel tetramerization domain containing protein 10)
  • Length: 313  
  • Mass: 35432
• Sequence:

  MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTDSEGWI
  LIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKVPVITSSKEEQ
  KLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKIAE
  VCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI
  HIKRPDDRAHLHQ

• Structural information:
  • Protein Domains: (32..10-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
  • Interpro: IPR000210  IPR011333  IPR003131  
  • Prosite: PS50097
  • PDB: 5FTA
  • PDBsum: 5FTA
  • STRING: ENSP00000228495
• Other Databases: GeneCards:  KCTD10  Malacards:  KCTD10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031463	Cul3-RING ubiquitin ligase complex	IBA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IBA	contributes to
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IBA	biological process
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0031463	Cul3-RING ubiquitin ligase complex	ISS	cellular component
GO:0004842	ubiquitin-protein transferase activity	ISS	contributes to
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0016567	protein ubiquitination	ISS	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0005112	Notch binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031463	Cul3-RING ubiquitin ligase complex	IBA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IBA	contributes to
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IBA	biological process
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0031463	Cul3-RING ubiquitin ligase complex	ISS	cellular component
GO:0004842	ubiquitin-protein transferase activity	ISS	contributes to
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0016567	protein ubiquitination	ISS	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0005112	Notch binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881