Search Result
| Gene id | 83884 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SLC25A2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ORC2, ORNT2 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | solute carrier family 25 member 2 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | mitochondrial ornithine transporter 2, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
5q31.3 (141304048: 141302634) Exons: 1 NC_000005.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This intronless gene encodes a protein that localizes to the mitochondrial inner membrane and likely functions as a transporter of small molecules such as ornithine. This gene is located between the protocadherin beta and gamma gene clusters on chromosome |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 606586 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9BXI2 Name: Mitochondrial ornithine transporter 2 (Solute carrier family 25 member 2) Length: 301 Mass: 32580 Tissue specificity: Expressed in liver, kidney, pancreas and cultured fibroblasts. | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYV AENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSH NTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWL VVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA Y | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SLC25A2  Malacards: SLC25A2 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||