• Gene id: 83882

Gene Summary

• Gene Symbol: TSPAN10   Gene   UCSC   Ensembl
• Aliases: OCSP
• Gene name: tetraspanin 10
• Alternate names: tetraspanin-10, oculospanin, tspan-10,
• Gene location: 17q25.3 (81637170: 81648754)     Exons: 5     NC_000017.11

Protein Summary

• Protein general information: Q9H1Z9  
  • Name: Tetraspanin 10 (Tspan 10) (Oculospanin)
  • Length: 355  
  • Mass: 36498
  • Tissue specificity: Expressed in the eye, including iris, ciliary body, retinal pigment epithelium, but not lens (protein level). {ECO
• Sequence:

  MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGTPKKGPAPSLSPGSSC
  VKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDPMLGLALGGLVVSAASLAGCLGALCENTCLL
  RGFSGGILAFLVLEAVAGALVVALWGPLQDSLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNL
  YFNCSSPGVQACSLPASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIA
  VVLLQGAELLLAARLLGALAARSGAAYGPGAHGEDRAGPQSPSPGAPPAAKPARG

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000480492
• Other Databases: GeneCards:  TSPAN10  Malacards:  TSPAN10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0072594	establishment of protein localization to organelle	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray