• Gene id: 83879

Gene Summary

• Gene Symbol: CDCA7   Gene   UCSC   Ensembl
• Aliases: ICF3, JPO1
• Gene name: cell division cycle associated 7
• Alternate names: cell division cycle-associated protein 7, c-Myc target JPO1,
• Gene location: 2q31.1 (173354860: 173368996)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene was identified as a c-Myc responsive gene, and behaves as a direct c-Myc target gene. Overexpression of this gene is found to enhance the transformation of lymphoblastoid cells, and it complements a transformation-defective Myc Box II mutant, su
• OMIM: 608519

Protein Summary

• Protein general information: Q9BWT1  
  • Name: Cell division cycle associated protein 7 (Protein JPO1)
  • Length: 371  
  • Mass: 42573
  • Tissue specificity: Ubiquitous with higher level in thymus and small intestine. Overexpressed in a large number of tumors, in blood from patients with acute myelogenous leukemia (AML) and in chronic myelogenous leukemia (CML) blast crisis. {ECO
• Sequence:

  MDARRVPQKDLRVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSVREGCRTRSQCRHSGPLRVAMK
  FPARSTRGATNKKAESRQPSENSVTDSNSDSEDESGMNFLEKRALNIKQNKAMLAKLMSELESFPGSFRGRHPLP
  GSDSQSRRPRRRTFPGVASRRNPERRARPLTRSRSRILGSLDALPMEEEEEEDKYMLVRKRKTVDGYMNEDDLPR
  SRRSRSSVTLPHIIRPVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPC
  LRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA

• Structural information:
  • Interpro: IPR033576  IPR040221  IPR018866  
  • STRING: ENSP00000306968
• Other Databases: GeneCards:  CDCA7  Malacards:  CDCA7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Immunodeficiency-centromeric instability-facial anomalies syndrome	KEGG:H02308
Immunodeficiency-centromeric instability-facial anomalies syndrome	KEGG:H02308
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq