• Gene id: 8386

Gene Summary

• Gene Symbol: OR1D5   Gene   UCSC   Ensembl
• Aliases: C17orf2, OR17-2, OR17-30, OR17-31, OR1D4
• Gene name: olfactory receptor family 1 subfamily D member 5
• Alternate names: olfactory receptor 1D5, olfactory receptor 17-31, olfactory receptor OR17-2,
• Gene location: 17p13.3 (228006997: 228067112)     Exons: 6     NC_000001.11
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Protein Summary

• Protein general information: P58170  
  • Name: Olfactory receptor 1D5 (Olfactory receptor 17 31) (OR17 31)
  • Length: 312  
  • Mass: 35424
• Sequence:

  MDGDNQSENSQFLLLGISESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMYFFLANLSFTDLFFVT
  NTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAYDRYVATCCPLHYVTAMSPGLCVLLLSLCWG
  LSVLYGLLLTFLLTRVTFCGPREIHYLFCDMYILLWLACSNTHIIHTALIATGCFIFLTPLGFMTTSYVRIVRTI
  LQMPSASKKYKTFSTCASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYRLRNKDMHGAP
  GRVLWRPFQRPK

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS50262
  • STRING: ENSP00000459028
• Other Databases: GeneCards:  OR1D5  Malacards:  OR1D5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004984	olfactory receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007608	sensory perception of smell	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)