• Gene id: 83855

Gene Summary

• Gene Symbol: KLF16   Gene   UCSC   Ensembl
• Aliases: BTEB4, DRRF, NSLP2
• Gene name: Kruppel like factor 16
• Alternate names: Krueppel-like factor 16, BTE-binding protein 4, basic transcription element binding protein 4, dopamine receptor regulating factor, novel Sp1-like zinc finger transcription factor 2, transcription factor BTEB4, transcription factor NSLP2, unknown transcript,
• Gene location: 19p13.3 (1863578: 1852398)     Exons: 2     NC_000019.10
• OMIM: 606139

Protein Summary

• Protein general information: Q9BXK1  
  • Name: Krueppel like factor 16 (Basic transcription element binding protein 4) (BTE binding protein 4) (Novel Sp1 like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2)
  • Length: 252  
  • Mass: 25431
• Sequence:

  MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGPGAAAA
  PHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYKSSHLKSHLRT
  HTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPGARST
  SPSDSLPCSLAGSPAPSPAPSPAPAGL

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000250916
• Other Databases: GeneCards:  KLF16  Malacards:  KLF16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0007212	dopamine receptor signaling pathway	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)