• Gene id: 83661

Gene Summary

• Gene Symbol: MS4A8   Gene   UCSC   Ensembl
• Aliases: 4SPAN4, CD20L5, MS4A4, MS4A8B
• Gene name: membrane spanning 4-domains A8
• Alternate names: membrane-spanning 4-domains subfamily A member 8, four-span transmembrane protein 4, membrane-spanning 4-domains, subfamily A, member 8B,
• Gene location: 11q12.2 (60699611: 60715806)     Exons: 7     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells a
• OMIM: 611966

Protein Summary

• Protein general information: Q9BY19  
  • Name: Membrane spanning 4 domains subfamily A member 8 (Four span transmembrane protein 4) (Membrane spanning 4 domains subfamily A member 8B)
  • Length: 250  
  • Mass: 26290
  • Tissue specificity: Expressed by hematopoietic tissues and cells lines.
• Sequence:

  MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAI
  QIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSA
  VGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIY
  AANPVITPEPVTSPPSYSSEIQANK

• Structural information:
  • Interpro: IPR007237  IPR030417  IPR030424  
  • STRING: ENSP00000300226
• Other Databases: GeneCards:  MS4A8  Malacards:  MS4A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq